DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and MCO14

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_011845.1 Gene:MCO14 / 856368 SGDID:S000001010 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:36/150 - (24%)
Similarity:58/150 - (38%) Gaps:50/150 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LYSPAAREAARAATGGSANLRRIHNTPTTEATATAITAKKRKMVVRLNEQERAEKLQPLL----- 109
            :::...|.|:.|.|||                         |::         |||:||.     
Yeast     1 MHNKIVRIASSALTGG-------------------------KLL---------EKLKPLTRWEVQ 31

  Fly   110 -DAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNKVDVTLSTHDV--- 170
             |...|...|   |.::...||:...::|:|.|::.:....|||.....|..|.:.|.|||:   
Yeast    32 WDPNKTKCLG---ITREVTFKDYETTWAFLTRVSMRSHLWGHHPLIHTSYTWVKLELHTHDIDPK 93

  Fly   171 ----GGLSSQDIRMATHLET 186
                ..||..|:|||..:::
Yeast    94 DGAHSQLSDIDVRMAKRIDS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 23/80 (29%)
MCO14NP_011845.1 PhhB 8..120 CDD:225065 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I3252
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - O PTHR12599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.