DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and AT1G29810

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_174274.2 Gene:AT1G29810 / 839859 AraportID:AT1G29810 Length:187 Species:Arabidopsis thaliana


Alignment Length:177 Identity:48/177 - (27%)
Similarity:77/177 - (43%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LFPTTATTATSRSLSQISVLY----------SPAAREAARAA-TGGSANLRRIHNTPTTEATATA 84
            ||..:.|...:.||  .:.||          |..:.::.|:: |||||:..|      |..:...
plant     9 LFSISRTQVPAASL--FNNLYRRHKRFVHWTSKMSTDSVRSSTTGGSASGAR------TFCSLAD 65

  Fly    85 ITAKK-----RKMVVRLNEQERAEKLQPLLDAGWTLVEGRDA--IFKQFVLKDFNQAFSFMTGVA 142
            ::.||     .|.:..:.||...:.||.:  |||.|....|.  :.:.:.:|.|.:...|...||
plant    66 LSTKKCVPCNAKDLRAMTEQSAQDLLQKV--AGWDLANDNDTLKLHRSWRVKSFTKGLDFFQRVA 128

  Fly   143 LLAEKINHHPE-----WFNCYNKVDVTLSTHDVGGLSSQDIRMATHL 184
            .:||...|||:     |    |.|.:.:.||.:|||:..|..:|..:
plant   129 DIAESEGHHPDLHLVGW----NNVKIEIWTHAIGGLTENDFILAAKI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 24/80 (30%)
AT1G29810NP_174274.2 PCD_DCoH_subfamily_a 96..174 CDD:238455 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4543
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2633
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - oto3543
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - O PTHR12599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.