DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and AT5G51110

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_199924.1 Gene:AT5G51110 / 835185 AraportID:AT5G51110 Length:220 Species:Arabidopsis thaliana


Alignment Length:78 Identity:20/78 - (25%)
Similarity:34/78 - (43%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GWTLVEGRDAIFK---QFVLKDFNQAFSFMTGVALLAEKINHHPE-WFNCYNKVDVTLSTHDVGG 172
            ||::|:......|   .:.::||......:..:..:||...|:|. ......:|...|.|..:||
plant   128 GWSIVDNEAGGLKIRCMWKVRDFGCGVELINRIHKVAEASGHYPSLHLESPTQVRAELFTSSIGG 192

  Fly   173 LSSQDIRMATHLE 185
            ||..|..||..::
plant   193 LSMNDFIMAAKID 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 20/78 (26%)
AT5G51110NP_199924.1 PCD_DCoH_subfamily_a 128..207 CDD:238455 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4543
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2633
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.