DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and HHP1

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_197527.1 Gene:HHP1 / 832149 AraportID:AT5G20270 Length:332 Species:Arabidopsis thaliana


Alignment Length:78 Identity:21/78 - (26%)
Similarity:34/78 - (43%) Gaps:11/78 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TAKKRKMVVRLNEQERAEKLQPLLD---AGWTLVEGRDAIFKQF-----VLKDFNQAFSFMTGVA 142
            |.|:|:::......|..:..:.:|:   |.|::   |||.|..|     .|..:.....|:..||
plant    50 TMKRRELMSYCELPEYMKDNEYILNYYRADWSI---RDAFFSVFSFHNESLNVWTHLIGFIFFVA 111

  Fly   143 LLAEKINHHPEWF 155
            |....|.||..:|
plant   112 LTVANIIHHDGFF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 15/49 (31%)
HHP1NP_197527.1 HlyIII 90..317 CDD:281059 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.