DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and Pcbd2

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_006517461.1 Gene:Pcbd2 / 72562 MGIID:1919812 Length:166 Species:Mus musculus


Alignment Length:165 Identity:59/165 - (35%)
Similarity:86/165 - (52%) Gaps:34/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AAREAARAATGGSANLRRIHNTPTTEATATAITAKKRKMVVRLNEQERAEKLQPLLDAGWTLVEG 118
            ||...|.||.|..:..|.:....:..|:..|:::..:    .|..:||.:.:..|..|||:.:..
Mouse     3 AAAAVAVAAVGARSAGRWLAALRSPGASRAAMSSDAQ----WLTAEERDQLIPGLKAAGWSELSE 63

  Fly   119 RDAIFKQFVLKDFN------------------------------QAFSFMTGVALLAEKINHHPE 153
            ||||:|:|..|:||                              |||.||:.|||.|||:|||||
Mouse    64 RDAIYKEFSFKNFNQLHSLLPAPFWPAALEHFLRLWPPPWRLPSQAFGFMSRVALQAEKMNHHPE 128

  Fly   154 WFNCYNKVDVTLSTHDVGGLSSQDIRMATHLETTA 188
            |||.||||.:||::||.|||:.:|:::|..:|..|
Mouse   129 WFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 43/103 (42%)
Pcbd2XP_006517461.1 PCD_DCoH_subfamily_b 57..162 CDD:238456 44/104 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845550
Domainoid 1 1.000 121 1.000 Domainoid score I5690
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4840
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - otm43144
orthoMCL 1 0.900 - - OOG6_100957
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2723
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.