DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and Pcbd2

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_003751690.1 Gene:Pcbd2 / 685729 RGDID:1590239 Length:129 Species:Rattus norvegicus


Alignment Length:93 Identity:51/93 - (54%)
Similarity:70/93 - (75%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNK 160
            |..:||::.:..|..|||:.:..||||:|:|..|:|||||.||:.|||.|||:||||||||.|||
  Rat    34 LTPEERSQLIPDLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNK 98

  Fly   161 VDVTLSTHDVGGLSSQDIRMATHLETTA 188
            |.:||::||.||||.:|:::|..:|..|
  Rat    99 VQITLTSHDCGGLSKRDVKLAQFIEKAA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 44/73 (60%)
Pcbd2XP_003751690.1 PCD_DCoH_subfamily_b 50..125 CDD:238456 45/74 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348963
Domainoid 1 1.000 119 1.000 Domainoid score I5660
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - otm45213
orthoMCL 1 0.900 - - OOG6_100957
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.640

Return to query results.
Submit another query.