Sequence 1: | NP_477360.2 | Gene: | Pcd / 43499 | FlyBaseID: | FBgn0024841 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000272.1 | Gene: | PCBD1 / 5092 | HGNCID: | 8646 | Length: | 104 | Species: | Homo sapiens |
Alignment Length: | 94 | Identity: | 57/94 - (60%) |
---|---|---|---|
Similarity: | 70/94 - (74%) | Gaps: | 0/94 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 RLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYN 159
Fly 160 KVDVTLSTHDVGGLSSQDIRMATHLETTA 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pcd | NP_477360.2 | PCD_DCoH_subfamily_b | 112..186 | CDD:238456 | 49/73 (67%) |
PCBD1 | NP_000272.1 | PCD_DCoH_subfamily_b | 24..99 | CDD:238456 | 50/74 (68%) |
Substrate binding. /evidence=ECO:0000250 | 61..63 | 0/1 (0%) | |||
Substrate binding. /evidence=ECO:0000250 | 78..81 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155089 | |
Domainoid | 1 | 1.000 | 119 | 1.000 | Domainoid score | I5799 |
eggNOG | 1 | 0.900 | - | - | E1_COG2154 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H57028 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2539 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002149 | |
OrthoInspector | 1 | 1.000 | - | - | otm41073 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100957 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12599 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2723 |
SonicParanoid | 1 | 1.000 | - | - | X2565 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.680 |