DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and Pcbd1

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001007602.1 Gene:Pcbd1 / 29700 RGDID:3263 Length:104 Species:Rattus norvegicus


Alignment Length:94 Identity:57/94 - (60%)
Similarity:70/94 - (74%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYN 159
            ||:.:||.:.|..|...||..:||||||||||..||||:||.|||.|||.|||::|||||||.||
  Rat     7 RLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYN 71

  Fly   160 KVDVTLSTHDVGGLSSQDIRMATHLETTA 188
            ||.:|||||:..|||.:||.:|:.:|..|
  Rat    72 KVHITLSTHECAGLSERDINLASFIEQVA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 49/73 (67%)
Pcbd1NP_001007602.1 PCD_DCoH_subfamily_b 24..99 CDD:238456 50/74 (68%)
Substrate binding 61..63 0/1 (0%)
Substrate binding 78..81 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348964
Domainoid 1 1.000 119 1.000 Domainoid score I5660
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H57028
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - otm45213
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - LDO PTHR12599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.