DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and omt2

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_594610.1 Gene:omt2 / 2541617 PomBaseID:SPAC27D7.04 Length:96 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:42/111 - (37%)
Similarity:63/111 - (56%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TEATATAITAKKRKMVVRLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVA 142
            |.|...|:.:|.:.                    .|.|.:|...:||.|..|:|.:|:.||:.||
pombe     3 TSARLLALVSKSKN--------------------NWILQQGDTKLFKSFRFKNFIEAWGFMSCVA 47

  Fly   143 LLAEKINHHPEWFNCYNKVDVTLSTHDVGGLSSQDIRMATHLETTA 188
            |.|:::||||||.|.|||||:||:|||..||:.:|:::|..::|.|
pombe    48 LRAQQLNHHPEWTNVYNKVDITLTTHDTKGLTEKDLKLAEFIDTLA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 36/73 (49%)
omt2NP_594610.1 PCD_DCoH_subfamily_b 17..92 CDD:238456 36/74 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2130
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - oto101047
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - O PTHR12599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2723
SonicParanoid 1 1.000 - - X2565
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.