DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and pcbd-1

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_491982.2 Gene:pcbd-1 / 188368 WormBaseID:WBGene00020397 Length:142 Species:Caenorhabditis elegans


Alignment Length:144 Identity:70/144 - (48%)
Similarity:88/144 - (61%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLSQISVLYSPAAREAARAATGGSANLRRIHNTPTTEATATAITAKKRKMVVRLNEQERAEKLQP 107
            |:|.:||.:.|                    :|.:....:|.|....||.:..|.|.||.|:|..
 Worm    15 SVSYLSVSHFP--------------------STSSHRLFSTTIGVFARKKMPLLTESERTEQLSG 59

  Fly   108 LLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNKVDVTLSTHDVGG 172
            |..|||.||||||||.|:|..||||:||.|||.|.|.|||::|||||||.|||||:||||||.||
 Worm    60 LKTAGWKLVEGRDAIQKEFHFKDFNEAFGFMTRVGLKAEKMDHHPEWFNVYNKVDITLSTHDCGG 124

  Fly   173 LSSQDIRMATHLET 186
            ||..|:::||.:|:
 Worm   125 LSPNDVKLATFIES 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 51/73 (70%)
pcbd-1NP_491982.2 PCD_DCoH_subfamily_b 64..139 CDD:238456 52/75 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163727
Domainoid 1 1.000 129 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3157
Isobase 1 0.950 - 0 Normalized mean entropy S2539
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - oto20538
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - LDO PTHR12599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2723
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.