DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcd and pcbd2

DIOPT Version :9

Sequence 1:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001238752.1 Gene:pcbd2 / 100489519 XenbaseID:XB-GENE-987706 Length:129 Species:Xenopus tropicalis


Alignment Length:116 Identity:56/116 - (48%)
Similarity:73/116 - (62%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HNTPTTEATATAITAKKRKMVVRLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSF 137
            |.|.|:||             ..|..:|:|..||.|...|||.|..::||:|::..|.|||||.|
 Frog    25 HRTQTSEA-------------YFLTPEEKAHGLQELQALGWTEVSEKNAIYKEYKFKTFNQAFGF 76

  Fly   138 MTGVALLAEKINHHPEWFNCYNKVDVTLSTHDVGGLSSQDIRMATHLETTA 188
            ||.|||.|||:||||||||.||||.:||:|||.|.|:.:|:::|..:|..|
 Frog    77 MTRVALQAEKMNHHPEWFNVYNKVQITLTTHDCGRLTKKDLKLAQFIEKAA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 43/73 (59%)
pcbd2NP_001238752.1 PCD_DCoH_subfamily_b 51..126 CDD:238456 44/74 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5959
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4708
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - otm48278
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.