DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99b and Obp99d

DIOPT Version :9

Sequence 1:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster


Alignment Length:66 Identity:18/66 - (27%)
Similarity:33/66 - (50%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAH 113
            |.:||.::....:||.|   |.|:.:|.|.:..|.|::..:|....||.    ::.:|:...:.|
  Fly    38 EDLEKCRQESQEEDAAT---LRCLVKKLGLWTDESGYNARRIAKIFAGH----NQMEELMLVVEH 95

  Fly   114 C 114
            |
  Fly    96 C 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 18/66 (27%)
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.