DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99b and Obp83a

DIOPT Version :9

Sequence 1:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:105 Identity:23/105 - (21%)
Similarity:45/105 - (42%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YRTQCVEKVHASEELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVE 100
            :...||||...:|..::::...:..:|....||:.|.|.:....|     |...:|::.....|.
  Fly    71 FHDACVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCFFHEIEVVD-----DNGDVHLEKLFATVP 130

  Fly   101 VHESDEVHQKIAHCAETHSKEGDS-CSKAYHAGMCFMNSN 139
            :...|::.:....|..   .|||: |.||:....|:..::
  Fly   131 LSMRDKLMEMSKGCVH---PEGDTLCHKAWWFHQCWKKAD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 23/101 (23%)
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D93539at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.