DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99b and Obp69a

DIOPT Version :9

Sequence 1:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:114 Identity:27/114 - (23%)
Similarity:54/114 - (47%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RTQCVEKVHASEELVEK-YKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVE 100
            |.:|:.:..||.::::| .|....|.|....|:|.|:|..||..|::   ::..:...|.....|
  Fly    39 RMRCLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQ---NIMHLEALLEVLPEE 100

  Fly   101 VHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNSNLQLVQHSVKV 149
            :|::  ::..::.|.....|:|  |..||....|::..|.:.:...:.|
  Fly   101 IHKT--INGLVSSCGTQKGKDG--CDTAYETVKCYIAVNGKFIWEEIIV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 25/100 (25%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.