DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99b and Obp28a

DIOPT Version :9

Sequence 1:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:54/144 - (37%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLIVLLLGLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPDDAVTHC 67
            ::.::|||.|.|.|   ....:.:.|..|...:    |:.:|.|::..:::..|.|........|
  Fly     8 LVAIVLLGAALVRA---FDEKEALAKLMESAES----CMPEVGATDADLQEMVKKQPASTYAGKC 65

  Fly    68 YLECIFQKFGF------YDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIA-----HCAETHSKE 121
            ...|:.:..|.      .|||.|.:..|   |..|       :|....|||     .||.. :..
  Fly    66 LRACVMKNIGILDANGKLDTEAGHEKAK---QYTG-------NDPAKLKIALEIGDTCAAI-TVP 119

  Fly   122 GDSCSKAYHAGMCF 135
            .|.|..|...|.||
  Fly   120 DDHCEAAEAYGTCF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 29/123 (24%)
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.