DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99b and Obp83g

DIOPT Version :9

Sequence 1:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:120 Identity:26/120 - (21%)
Similarity:54/120 - (45%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHK 89
            :::|.|.|......:|.|..:..:::.|||..:::|....|.|:::|..:|...:..:.|||...
  Fly    25 FLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCFVKCFLEKLELFSEKKGFDERA 89

  Fly    90 IHIQLAGPGVEVHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNSNLQLVQ 144
            :..|......:  :...|...:..|.:.:..|.|.|:.|.....|::..|..:|:
  Fly    90 MIAQFTSKSSK--DLSTVQHGLEKCIDHNEAESDVCTWANRVFSCWLPINRHVVR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 24/111 (22%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBJK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D93539at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.