DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp99b

DIOPT Version :10

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_651713.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:66 Identity:18/66 - (27%)
Similarity:33/66 - (50%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDLEKCRQESQEEDAAT---LRCLVKKLGLWTDESGYNARRIAKIFAGH----NQMEELMLVVEH 95
            |.:||.::....:||.|   |.|:.:|.|.:..|.|::..:|....||.    ::.:|:...:.|
  Fly    49 ELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAH 113

  Fly    96 C 96
            |
  Fly   114 C 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 18/66 (27%)
Obp99bNP_651713.1 PBP_GOBP 24..137 CDD:460193 18/66 (27%)

Return to query results.
Submit another query.