powered by:
Protein Alignment Obp99d and Obp99b
DIOPT Version :9
Sequence 1: | NP_651712.1 |
Gene: | Obp99d / 43496 |
FlyBaseID: | FBgn0039684 |
Length: | 137 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001263078.1 |
Gene: | Obp99b / 43497 |
FlyBaseID: | FBgn0039685 |
Length: | 149 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 33/66 - (50%) |
Gaps: | 7/66 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 EDLEKCRQESQEEDAAT---LRCLVKKLGLWTDESGYNARRIAKIFAGH----NQMEELMLVVEH 95
|.:||.::....:||.| |.|:.:|.|.:..|.|::..:|....||. ::.:|:...:.|
Fly 49 ELVEKYKKWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAH 113
Fly 96 C 96
|
Fly 114 C 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.