DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp99c

DIOPT Version :9

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster


Alignment Length:145 Identity:37/145 - (25%)
Similarity:62/145 - (42%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIAMAVSTEA-ASVWKLPTAQMVYEDLEKCRQESQEEDAAT---------------------LR 56
            |::|:|:...| |..|...|.    |::.|.|.:..:|:..:                     |.
  Fly     5 LIVALALCAVAHADDWTPKTG----EEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPDVRQYLT 65

  Fly    57 CLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRMEQDTSHLDDWAFLAYRCATSGQ 121
            |...|||::.|:.||:|.|:||.|......||.:.:.:.|.......:..|.|||..::|..:.:
  Fly    66 CSAIKLGIFCDQQGYHADRLAKQFKMDLSEEEALQIAQSCVDDNAQKNPTDVWAFRGHQCMMASK 130

  Fly   122 FGHWVKDFMSQKEVE 136
            .|..|:.|:..|..|
  Fly   131 IGDKVRAFVKAKAEE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 24/98 (24%)
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.