DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp83cd

DIOPT Version :10

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:93 Identity:20/93 - (21%)
Similarity:36/93 - (38%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDLEKCRQ--ESQEEDAATLRCLVKKL-GLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRM 99
            |.||:.::  :|.||.....||.:.:: ..:.:.:|:|...|..:|.        ..|.|.|.:.
  Fly    47 ERLERFKEWSDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFG--------RPVYEACRKK 103

  Fly   100 --------EQDTSHLDDWAFLAYRCATS 119
                    |....|    |:..:.|.|:
  Fly   104 LELPFESGESSCKH----AYEGFHCITN 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 18/88 (20%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 20/93 (22%)
PhBP 149..242 CDD:214783
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.