DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp56g

DIOPT Version :9

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster


Alignment Length:81 Identity:15/81 - (18%)
Similarity:35/81 - (43%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLE--KCRQESQEEDA-ATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRME 100
            ||:  |.:.|..:::. .:.:|::.|.|...........:|...:|..|..:.:...::.|:.::
  Fly    49 DLQSGKVKAEDAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVK 113

  Fly   101 QDTSHLDDWAFLAYRC 116
              .::..|.||....|
  Fly   114 --GANACDTAFKILSC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 14/79 (18%)
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.