DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp56f

DIOPT Version :9

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:72 Identity:14/72 - (19%)
Similarity:33/72 - (45%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QMVYEDLEKCRQESQEEDAAT---LRCLVKKLGLWTDE--SGYNARRIAKIFAGHNQMEELMLVV 93
            |:.|...|..:.:::|:...:   ..||::..|:..::  |....|::.:...|....:||....
  Fly    33 QLGYTITENTKFDAKEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAE 97

  Fly    94 EHCNRME 100
            |.|:.::
  Fly    98 EKCHSIK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 12/68 (18%)
Obp56fNP_725926.1 PBP_GOBP <52..120 CDD:279703 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.