DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrtc1a

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006528343.1 Gene:Dmrtc1a / 70887 MGIID:1918137 Length:227 Species:Mus musculus


Alignment Length:234 Identity:44/234 - (18%)
Similarity:74/234 - (31%) Gaps:72/234 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 SPPSDGFEASSTPNHHQQSQQQQQAHHQQHLSHPH------QQSQRFNGN-----ESDTDGRTRS 202
            ||.:...:..:||...:..::.::.....|.||.|      ::..|...|     ::..|..|:.
Mouse    15 SPVTTSKKEEATPLKRRLVERHKRTMAAAHPSHMHVKKLAVEEGVRTGKNTVQQIQAQVDTATQE 79

  Fly   203 EHLSVGFSPTRTELDESPVSKRGAALSNETDQDT------------------GSESGSPSSPRPK 249
            |                  |.:|..|.|:..:.|                  |...|:.:.|...
Mouse    80 E------------------SSQGPVLLNQHPETTSVPYTPETVGQQLMVSLPGEPHGTSAMPSMC 126

  Fly   250 VAGLFNLTAS-----LSPARTGPPSSPESDLDVDSAPDE--ATPENLSLKKEDSQS------PPN 301
            .:.:....|:     |.|...||.:|.::.:.......|  ...|.|...|..||:      .|.
Mouse   127 PSLILQPCATTDPMLLQPQVMGPSASNQASVSATLEWQEMLEAAEALLALKNSSQTRHQPCGMPG 191

  Fly   302 TPAE-NLHLLRSFSSSHAQGFLPYHHTQFLAAAGLPAHH 339
            |..| .|.|        |...:|...|   ::..||:.|
Mouse   192 TAGERGLQL--------ANPSMPPRPT---SSGSLPSGH 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137
CUE_DMA_DMRTA1 378..415 CDD:270600
Dmrtc1aXP_006528343.1 DMRT-like 112..226 CDD:374115 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.