DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and C18orf63

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001167594.1 Gene:C18orf63 / 644041 HGNCID:40037 Length:685 Species:Homo sapiens


Alignment Length:235 Identity:51/235 - (21%)
Similarity:80/235 - (34%) Gaps:69/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 PKVAGLFNLTASLSPARTGPPSSPESDLDVDSAP----DEATPENLSLKKEDSQSPPNTPAENLH 308
            |:|.....|.:.||..::..|......:.:.|.|    .|.|..|:   :|....|||...:.  
Human   280 PRVDSEVVLKSFLSDLKSKLPHICGFPIKMTSKPCYYTQELTKPNI---QEHKVKPPNLTTKK-- 339

  Fly   309 LLR-------SFSSSHAQGFLP----YHHTQFLAAAGLPAHHHPAA--HSPHHQQQQQQQQQQQN 360
            :||       |...:.||..||    ..|...|:.:      .|.:  .|..|.|.:..|.::::
Human   340 MLRASLTQATSRKPACAQSLLPCSVAVDHKVELSVS------QPTSGIFSALHLQPESVQGRKKS 398

  Fly   361 ---HLPQHHQQQQQQQQQQQRSPIDVLMRVFPNRRRSDVEQLMQRFRGDVLQAMECMLAGEDLGQ 422
               ..||.|.              :|||   |||..:.|:......:.::               
Human   399 LSIRAPQVHS--------------EVLM---PNRGNTQVQHTNLSSQSNI--------------- 431

  Fly   423 TPPQVPPSPPFPMKSAFSPL-VPPSVFGSPTHRYHPFMQA 461
            ||..||     ..|:....: ...||.|||..:.|...|:
Human   432 TPKFVP-----VFKNRLLQMNKNTSVLGSPKRKQHDVTQS 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137
CUE_DMA_DMRTA1 378..415 CDD:270600 7/36 (19%)
C18orf63NP_001167594.1 DUF4708 7..280 CDD:292441 51/235 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 635..685
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.