DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrt1

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_030106845.1 Gene:Dmrt1 / 50796 MGIID:1354733 Length:475 Species:Mus musculus


Alignment Length:266 Identity:95/266 - (35%)
Similarity:122/266 - (45%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LRAASERYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQ 92
            |.:.|::..|.||||||||||..|.||||||:|.||||.|.||:|||||||||||||||||||||
Mouse    61 LGSGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQ 125

  Fly    93 EENEARELGLLY---------TSVPGQQNGSD---------SATPTPHS-PNHSGSGGSGSGGSG 138
            ||    |||:.:         ..|..:.|.|:         ||.|.|.| |..:.|.|.      
Mouse   126 EE----ELGISHPIPLPSAAELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASEGR------ 180

  Fly   139 QNGVFHGGIPSPPSDGF-----EASSTPNHHQQSQQQQQAHHQQHLSHPHQQSQRFNGNESDTDG 198
               :....||:..|.|.     :..|.|.::....|.....:..:|.:..|.|...:...|  .|
Mouse   181 ---MVIQDIPAVTSRGHMENTSDLVSDPAYYSSFYQPSLFPYYNNLYNYPQYSMALSAESS--SG 240

  Fly   199 RTRSEHLSVGFSPTRTELDESPVSKRGAALSNETDQDTGSESGSPSSPRPKVAGLFNLTASLSPA 263
            ...:   |:|.||.:..|...|.....|...|:....| |||..|.|.:.::...:         
Mouse   241 EVGN---SLGGSPVKNSLRSLPAPYVPAQTGNQWQMKT-SESRHPVSSQYRMHSYY--------- 292

  Fly   264 RTGPPS 269
              ||||
Mouse   293 --GPPS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 36/45 (80%)
CUE_DMA_DMRTA1 378..415 CDD:270600
Dmrt1XP_030106845.1 DM 70..116 CDD:366283 36/45 (80%)
Dmrt1 128..200 CDD:372081 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.