DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmrt11E

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster


Alignment Length:174 Identity:68/174 - (39%)
Similarity:83/174 - (47%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAR 98
            |..|||||||||||||:|.:|||||.||||:|.|..|.|:.:|||||||||||||||..|..||.
  Fly   115 RLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEAT 179

  Fly    99 ELGLLYTSV-------PGQQNGSDSATPTPHSPNHSGSGGSGSGGSGQNGVFHGGIPSPPSDGFE 156
            ......|.|       .....|.||.:.|...|.||                |....|.|:....
  Fly   180 ASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHS----------------HPHSHSHPTSCVS 228

  Fly   157 ASSTPNHHQQSQQQQQAHHQQHLSHPHQQS-----------QRF 189
            .||:.:..:|:...|:..::|.|....|.:           |||
  Fly   229 NSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 33/45 (73%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmrt11ENP_511146.2 DM 118..164 CDD:279137 33/45 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.