DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrtb1

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001178690.1 Gene:Dmrtb1 / 313484 RGDID:1560921 Length:348 Species:Rattus norvegicus


Alignment Length:388 Identity:95/388 - (24%)
Similarity:139/388 - (35%) Gaps:111/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEARELG 101
            |||||:||||||.:..:|||...|||:.|:|.||.||.|||::||||..|:.|..:|:...  :|
  Rat     3 RTPKCSRCRNHGYLVPVKGHAGKCRWKHCICDKCYLITERQKIMAAQKVLKNQATEEQGAT--VG 65

  Fly   102 LLYTSVPGQQNGSDSATPTPHSPN-----HSGSGGSGSG-------------------------- 135
            .....:|.:.....:||.|..|.:     .:..||:|.|                          
  Rat    66 TQGPQLPPRAPAPAAATATASSSSICPLPRAALGGAGPGPAATCFLERSPQARSPGPSAFQLVPS 130

  Fly   136 ----------GSGQNGVFHGGIPSPPSDGFEASSTPNHHQQSQQQQQAHHQQHLSHPHQQSQRFN 190
                      |||.:|..|   ..||      :..|....|:.:.:.....|||  |.:...|..
  Rat   131 GRPGPSTFQPGSGGSGGLH---DRPP------AWLPQLRPQAPRPELCCPDQHL--PVRPVPRLP 184

  Fly   191 GNESDTDGRTRSEHLSVGFSPTRTELDESPV-----SKRGAALSNETDQDTGSESGSPSSP--RP 248
            ..:.....|.:|:|:.....|.|....:.|.     ..:...||.  .||:.|..|.|...  |.
  Rat   185 FADYGHPLRFKSDHVVGAGYPEREPFKQCPACIPVPPYQPFPLSE--GQDSSSALGVPQQRGFRH 247

  Fly   249 KVAGLFNLTASLS-PAR--------------TGPPSSPESDLDVDSAPDEATPENLSLKK--EDS 296
            ...|.::..:.:| |||              ..||..|:.       |....|..||...  ...
  Rat   248 VSCGPYHGNSLVSEPARDLQPTYCSPPPPPLPPPPPQPQQ-------PHFLPPGYLSALHFLPPP 305

  Fly   297 QSPPNTPAENLHLL--RSFSSSHAQGFLPYHHTQFLAAAGLPAHHHPAAHSPHHQQQQQQQQQ 357
            ..||:.|:.:|.:|  .....::.||                      |.:|....||..|::
  Rat   306 PPPPSPPSFSLTILYDTDKEKTNEQG----------------------ADAPSEPSQQSTQEE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 28/45 (62%)
CUE_DMA_DMRTA1 378..415 CDD:270600
Dmrtb1NP_001178690.1 DM 3..49 CDD:279137 28/45 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003936
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.