DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrt2

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001101067.1 Gene:Dmrt2 / 309430 RGDID:1309047 Length:560 Species:Rattus norvegicus


Alignment Length:416 Identity:111/416 - (26%)
Similarity:148/416 - (35%) Gaps:136/416 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PVLGALPPAFFL---------RAASERYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTL 72
            |...|||.|..:         .|...:..|||||||||||||||.||||||:||||||.||.|.|
  Rat    88 PAAQALPAAAVVPERGVTAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLL 152

  Fly    73 IAERQRVMAAQVALRRQQAQEENEARELGLLYTSVPGQQNGSDSAT------------------- 118
            :.|||||||||||||||||.|:.:         .:.|:||..|...                   
  Rat   153 VVERQRVMAAQVALRRQQATEDKK---------GLSGKQNNFDRKAVYQRQVRAPSLLAKSILEG 208

  Fly   119 --PTPHSPNHSGSGGSGSGGSGQNGVFHGGIPSPP--SDGF-EASSTPNHHQQSQQQQQAHHQQH 178
              |...:..:.|                |.:|.||  ||.. :..:..:...::...::.:.::.
  Rat   209 YRPMTAAETYLG----------------GTLPLPPPVSDRMRKRRAFADKELENIMLEREYKERE 257

  Fly   179 LSHPHQQSQRFNGNESDTDGRTRSEHLSVGFSPTRTELDESPVSKRGAALSNETDQDTGSESGS- 242
            :....|.:..|..|.. ..|...|.:.. .|||:..||.............:.|.|.:||.:.. 
  Rat   258 MLETSQAAALFLPNRM-VPGPEYSSYKG-AFSPSAGELPSKDFCNFLPTCLDLTMQYSGSGNMEL 320

  Fly   243 --------------PSSPR----PKVAG----------LFNLTAS-------------------- 259
                          |.|.|    ||...          |.|.|.|                    
  Rat   321 ISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQYLLNATTSVQALKPGAGWDLKGTRVQDG 385

  Fly   260 LSPARTGPPSSPESDL-----------DVDSAPDEATPENLSLKKEDSQSPPN---TPAENL--- 307
            ||....|.|..||..|           ..|....:|.||..:.      |||:   :|..::   
  Rat   386 LSAEHDGMPPKPEGSLVLPQLSEVPTSRTDLQAHQAVPERSAF------SPPSRNFSPIVDMDCL 444

  Fly   308 ----HLLRSFSSSHAQGFLPYHHTQF 329
                |:|...|..:.:..||.....|
  Rat   445 AAQGHVLTKISKENTRYPLPLKRNPF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 38/45 (84%)
CUE_DMA_DMRTA1 378..415 CDD:270600
Dmrt2NP_001101067.1 DM 117..163 CDD:395608 38/45 (84%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.