DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmrt2a

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_571027.1 Gene:dmrt2a / 30129 ZFINID:ZDB-GENE-990621-7 Length:507 Species:Danio rerio


Alignment Length:375 Identity:107/375 - (28%)
Similarity:136/375 - (36%) Gaps:97/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAR 98
            :..|||||||||||||||.||||||:||||||.||.|.|:.|||||||||||||||||.|:.:  
Zfish    54 KLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKK-- 116

  Fly    99 ELGLLYTSVPGQQNGSDSATPTP-----------HSPNHSGSGGSGSGGSGQNGVFHG---GIPS 149
              |:....:|.::.........|           :.|             .||..|.|   .:|.
Zfish   117 --GITGKQIPVERRNIYQRHIRPSTMLAKSILEGYRP-------------VQNDPFLGANPALPP 166

  Fly   150 PPSDG----------------FEASSTPNHHQQSQQQQQAH-----HQQHLSHPHQQSQRFNGNE 193
            |.||.                .|.........:|.|...|.     ...|.:..:.....|:...
Zfish   167 PLSDRMRKRRAFADKELETIMLEREYKERELLESTQSNSASLFMPGSMVHAAEYNSYKTAFSSAS 231

  Fly   194 SDTDGRTRSEHLSVGFSPTRTELDESPVSKRGAALSNETDQDTGSESGS----PSSPR----PKV 250
            :.:......:.| .||.|...:|.....:..|...:.|......|.:.:    |.|||    |:.
Zfish   232 APSTVEPSPKDL-CGFLPGCLDLSLQYAATGGTTANVELISSNVSVATTYRQYPLSPRFVMWPRG 295

  Fly   251 AG-----------LFNLTA--SLSPARTGPP---SSPESDLDVDSAP------DEATPENLSLKK 293
            :.           |.|.||  :|.|.....|   ||.||......||      ....||:     
Zfish   296 SSSISDALLYQQCLLNATAVQNLKPGAVWDPKMMSSTESHPPEQDAPASRLEGSRVAPES----- 355

  Fly   294 EDSQSPPNTPAENLHLLRSFSSSHAQGFLPYHHTQ---FLAAAGLPAHHH 340
            .|.|..|......|    ..:......|.|...|.   |...||  :|.|
Zfish   356 SDLQPGPREAQTGL----GHNGGARSAFSPPKRTYGQVFSPQAG--SHEH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 38/45 (84%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmrt2aNP_571027.1 DM 57..103 CDD:279137 38/45 (84%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.