DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrt3

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001099828.1 Gene:Dmrt3 / 293976 RGDID:1306043 Length:476 Species:Rattus norvegicus


Alignment Length:492 Identity:135/492 - (27%)
Similarity:177/492 - (35%) Gaps:214/492 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 100
            ||||||||||||||:|.|||||||||::||.|.||.||.|||||||||||||||||.|.      
  Rat    24 QRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANES------ 82

  Fly   101 GLLYTSVPGQQNGSDSATPTPHSPNHSGSGGSGSGGSGQNGVFHGGIPSPPSDGFEASSTPNHHQ 165
              |.:.:|      ||..                           .:|.||..| :|::|.....
  Rat    83 --LESLIP------DSLR---------------------------ALPGPPPPG-DAAATAATAS 111

  Fly   166 QSQQQQQAHHQQHLSHPHQQSQRFNGNESDTDGRTRSEHLSVGFSPTR--TELDESPVSKRGAAL 228
            ||....||      |.|.                          :|.|  |||      ...|||
  Rat   112 QSSPASQA------SQPP--------------------------APPRPATEL------AAAAAL 138

  Fly   229 SNETDQDTGSESGSPSSPRPKVAGLFNLTASLSPARTGPPSSPE------SDLDVD--SAPDEA- 284
            ....:...|:.....:.|            .|:..|.|..||.:      ||.|.|  |:||.. 
  Rat   139 RWVAEPQPGTLPAQIAKP------------DLTEDRLGDSSSADNAAESFSDKDTDQRSSPDVVK 191

  Fly   285 -----TPENLSLKKEDS------------QSPPNTP---AENLHLLRSFSSSHAQGFLPYHHTQF 329
                 |||:..:...|.            :|.|::|   ||..|||....|....  ||:     
  Rat   192 SKNCFTPESPEIVSVDEGGYAVQKNGGNPESCPDSPKYHAEQSHLLIEGPSGTVS--LPF----- 249

  Fly   330 LAAAGLPAHHHPAAHSPHHQQQQQQQQQQQNHLPQHHQQQQQQQQQQQRSPIDVLMRVFPNRRRS 394
                .|.|:                                       |.|::||.::|||::.:
  Rat   250 ----SLKAN---------------------------------------RPPLEVLKKIFPNQKPT 271

  Fly   395 DVEQLMQRFRGDVLQAMECML------AGED-------------------LGQTPP--------- 425
            .:|.:::...||::.|:|.:|      ||.:                   ||..|.         
  Rat   272 VLELILKGCGGDLVSAVEVLLSSRSSAAGAERTAEESLVLPSSGHIFEHTLGSYPISSSKWSVGS 336

  Fly   426 --QVPPSPPFPMKSAFSPLVPPSVFGSPTHRYHPFMQ 460
              :||.:..|   ||.|..|.|:....|..  |||.|
  Rat   337 AFRVPDTLRF---SADSSNVVPNPLAVPLQ--HPFPQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 37/45 (82%)
CUE_DMA_DMRTA1 378..415 CDD:270600 12/36 (33%)
Dmrt3NP_001099828.1 DM 25..71 CDD:395608 37/45 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..130 16/100 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..195 14/59 (24%)
CUE_DMA_DMRTA3 253..295 CDD:270602 14/80 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12176
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.