DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and mab-23

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001041089.1 Gene:mab-23 / 266926 WormBaseID:WBGene00003114 Length:175 Species:Caenorhabditis elegans


Alignment Length:122 Identity:37/122 - (30%)
Similarity:55/122 - (45%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ERYQRTPKCARCRNHGVVS-ALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENE 96
            |:|.    |..|.|||:.: ..||||:.|.:|.|.|:.|.|..:|:.:...:     :|.:..||
 Worm     4 EQYM----CQLCANHGIFNQPKKGHKQKCPYRTCPCSLCALNTKRRALDQIE-----RQLKHTNE 59

  Fly    97 ARELGLLYTSV--PGQQNGSDSATP--TPHSPNHSGSGGSGSGGSGQNGVFHGGIPS 149
            .. .|...||:  |..:......||  |||:|. ||.....:..|..|..|...:|:
 Worm    60 PM-TGQTATSMASPTPECPLSPTTPKMTPHTPT-SGKDTFRNSISSSNMAFTVQLPA 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 16/46 (35%)
CUE_DMA_DMRTA1 378..415 CDD:270600
mab-23NP_001041089.1 DM 6..55 CDD:383022 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.