DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmd-9

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_500305.1 Gene:dmd-9 / 190512 WormBaseID:WBGene00022060 Length:254 Species:Caenorhabditis elegans


Alignment Length:303 Identity:52/303 - (17%)
Similarity:88/303 - (29%) Gaps:120/303 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AASERYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEE 94
            ||.::..:...|.:|..||..:.||||...|.::||.|..|..:..    |.|...:||.:.::.
 Worm    20 AAQKKAMKKLTCRKCEGHGTYAILKGHAGVCPYKDCSCGTCASVMS----MRANALIRRFRHRQP 80

  Fly    95 NEARELGLLYTSVPGQQNGSDSATPTPHSPNHS---GSGGSGSGGSGQNGVFHGGIPSPPSDGFE 156
            :::    :........:||:......|.:...:   ..|...:..|.:||               
 Worm    81 DQS----MAVVKALRSKNGNMRLRIVPRNDEETVVENDGTLVTYSSDKNG--------------- 126

  Fly   157 ASSTPNHHQQSQQQQQAHHQQHLSHPHQQSQRFNGNESDTDGRTRSEHLSVGFSPTRTELDESPV 221
                              ||.:                                        :..
 Worm   127 ------------------HQTY----------------------------------------TTT 133

  Fly   222 SKRGAALSNETDQDTGSESGSPSSPRPKVAGLFNLTASLSPARTGPPSSPESDLD--VDSA---- 280
            ::|.:.::|.||......|..||:..       |.|.|.||    |...|..|:|  ||..    
 Worm   134 TRRSSIMTNSTDDRDSVVSTPPSTTN-------NSTPSGSP----PLLVPYGDVDIAVDPVGAAN 187

  Fly   281 -------------------PDEATPENLSLKKEDSQSPPNTPA 304
                               |...:|..:|...:.:|.|...|:
 Worm   188 WEQITNIVRTTMLNQILMNPTNVSPALISFLLQPTQQPSFEPS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 14/45 (31%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmd-9NP_500305.1 DM 27..79 CDD:214606 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.