DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmd-3

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001256882.1 Gene:dmd-3 / 189878 WormBaseID:WBGene00012832 Length:250 Species:Caenorhabditis elegans


Alignment Length:150 Identity:49/150 - (32%)
Similarity:65/150 - (43%) Gaps:43/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 100
            :|.|.|.||..|.||:.||||||.|.:|||.||||.::.|||::||.|:.|||:|.:|:|..   
 Worm   112 ERRPNCQRCAQHSVVNRLKGHKRACPFRDCFCAKCQVVVERQKLMADQIKLRRRQKREKNNL--- 173

  Fly   101 GLLYTSVPGQQNGSDSATPTPHSPNHSGSGGSGSGGSGQNGVFHGGIPSPPSDGFEASSTPNHHQ 165
                        .|:...|..||...|                       |.|....::||....
 Worm   174 ------------NSEREAPIAHSMTPS-----------------------PIDTVTTTTTPTSET 203

  Fly   166 QSQQ-----QQQAHHQQHLS 180
            .:..     ||...:||.||
 Worm   204 STPMCLKCAQQVIGYQQLLS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 27/45 (60%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmd-3NP_001256882.1 DM 15..60 CDD:366283
DM 113..166 CDD:214606 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.