DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmd-10

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001379162.1 Gene:dmd-10 / 183202 WormBaseID:WBGene00007929 Length:348 Species:Caenorhabditis elegans


Alignment Length:277 Identity:74/277 - (26%)
Similarity:103/277 - (37%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 100
            :|.|.|.:|..||..|.||||||.|.:|:|.||||.:::|||::||.|:.:||:|.::       
 Worm   114 ERVPNCQKCGQHGRKSRLKGHKRSCPFRECPCAKCAVVSERQKLMADQIKIRRRQRKD------- 171

  Fly   101 GLLYTSVPGQQNGSDSATPTPHSPNHSGSGGSGSGGSGQNGVFHGGI---PSP----PSDGFEAS 158
             .|.|.      ..:|.|.|....|....       :..|.:.:|.|   |.|    |:....:|
 Worm   172 -TLLTF------AKNSITSTMFPSNQISL-------NALNSLLYGSINTSPQPLLSSPTSSDASS 222

  Fly   159 STPNHHQQSQQQQQAHHQQHLSHPHQQS-QRFNGNESDTDGRTRSEHLSV-----GFSPTRTELD 217
            .:|                  |.|...| ..|....:|....|::...|:     ..||..|.| 
 Worm   223 CSP------------------SMPFTPSIPMFMPTSADCSPTTQTPTSSIPSSIASTSPLMTSL- 268

  Fly   218 ESPVSKRGAALSNETDQDTGSESGSPSSPRPKVAGLFNLTAS----------------LSPARTG 266
              |:...|..|.|..|         ||:.    |.|.||..:                |..|...
 Worm   269 --PLRLSGFPLLNIRD---------PSAE----ASLLNLGCNADAAALLKTILDQYRMLEEASMS 318

  Fly   267 PPSSPESDLDVDSAPDE 283
            ..|||..|   |.:.||
 Worm   319 MSSSPSKD---DESGDE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 25/45 (56%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmd-10NP_001379162.1 DM 39..92 CDD:214606
DM 115..168 CDD:214606 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.