DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and dmd-4

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_510466.1 Gene:dmd-4 / 181581 WormBaseID:WBGene00007776 Length:260 Species:Caenorhabditis elegans


Alignment Length:252 Identity:81/252 - (32%)
Similarity:120/252 - (47%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 100
            :|.||||||||||:||.||||||:|::::|.|.||.|||||||||||||||:|:||.|  :|..|
 Worm    17 ERKPKCARCRNHGLVSWLKGHKRHCKYKECACEKCNLIAERQRVMAAQVALKRRQATE--DAIAL 79

  Fly   101 GLLYTSVPGQQNGSDSATPTPHSPNHSGSGGSGSGGSGQNGVFHGGIPSPPSDGFEASSTPNHHQ 165
            ||  ..|.||     :....|..|..:.:||........:.......|:|.|:    ...|...:
 Worm    80 GL--RVVAGQ-----AIDRLPQGPVWNTAGGEDEDMDYLDEEIEEKPPTPVSE----ELVPLKRK 133

  Fly   166 QSQQQQQ--------------AHHQQHL-------SHPH--QQSQRF-------NGNESDT-DGR 199
            :.::..:              ..|::|:       .|.:  |..:.|       |.|:... ...
 Worm   134 KVEETYELSSFSPIELLMTLFCEHEKHVLELVLEACHGNVLQAIEHFANVRRVKNINQMKLFAAA 198

  Fly   200 TRSEHLSVGFS----PTRTELDES-------PVSKRGAALSNETDQDTGSESGSPSS 245
            ||.:|:....:    |.::.|.:|       |||.: |:.|.:|...:..:|.||:|
 Worm   199 TRMDHVFPNMTNFILPKQSFLIDSLLEQPTFPVSSQ-ASTSTKTCDSSSVDSISPNS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 34/45 (76%)
CUE_DMA_DMRTA1 378..415 CDD:270600
dmd-4NP_510466.1 DM 18..64 CDD:366283 34/45 (76%)
CUE_DMA 142..181 CDD:270553 4/38 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3693
SonicParanoid 1 1.000 - - X984
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.