DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and mab-3

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001022464.1 Gene:mab-3 / 174533 WormBaseID:WBGene00003100 Length:290 Species:Caenorhabditis elegans


Alignment Length:130 Identity:44/130 - (33%)
Similarity:67/130 - (51%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MQNLMSQHPVLGALPPAFFLRAASERYQRTPKCARCRNHGVVSALKGHKR-YCRWRDCVCAKCTL 72
            :.||:|:..:  ...||  .:....:..|.|.||||..|||:..|:|||| .|::..|.|..|||
 Worm    66 LNNLLSKKKI--HCTPA--TQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCECTLCTL 126

  Fly    73 IAERQRVMAAQVALRRQQAQEENEARELG--------------LLYTSVPGQQNGSDSATPTPHS 123
            :..|:.:||||:.|||.| |:..:.:|..              ::.|:..||:....||:|:|.|
 Worm   127 VEHRRNLMAAQIKLRRSQ-QKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKIIGTSASPSPSS 190

  Fly   124  123
             Worm   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 23/46 (50%)
CUE_DMA_DMRTA1 378..415 CDD:270600
mab-3NP_001022464.1 DM 24..77 CDD:214606 3/12 (25%)
DM 90..144 CDD:214606 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.