DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt99B and Dmrt1

DIOPT Version :9

Sequence 1:NP_524549.1 Gene:dmrt99B / 43495 FlyBaseID:FBgn0039683 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_446158.1 Gene:Dmrt1 / 114498 RGDID:621640 Length:374 Species:Rattus norvegicus


Alignment Length:326 Identity:110/326 - (33%)
Similarity:143/326 - (43%) Gaps:68/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LRAASERYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQ 92
            |.:.|::..|.||||||||||..|.||||||:|.||||.|.||:|||||||||||||||||||||
  Rat    61 LGSGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQ 125

  Fly    93 EENEARELGLLYTSVP---------GQQN----------GSDSATPTPHS-PNHSGSGGSGSGGS 137
            ||    |||:.: .:|         .::|          .|.||.|.|.| |..:.|.|.     
  Rat   126 EE----ELGISH-PIPLPSAAELLVKRENSASNPCLMAESSSSAQPPPASTPTPTVSEGR----- 180

  Fly   138 GQNGVFHGGIPSPPSDGF-----EASSTPNHHQQSQQQQQAHHQQHLSHPHQQSQRFNGNESDTD 197
                :....||:..|.|.     :..|.|.::....|.....:..:|.:..|.|...:...|..|
  Rat   181 ----MVIQDIPAVTSRGHMENAPDLMSDPAYYSSFYQPSLFPYYNNLYNYPQYSMALSAESSSGD 241

  Fly   198 -GRTRSEHLSVGFSPTRTELDESPVSKRGAALSNETDQDTGSESGSPSSPR---------PKVAG 252
             |.      .:|.||.:..|...|.....|...|:....| ||...|.|.:         |...|
  Rat   242 VGN------PLGGSPVKNSLRSLPAPYVPAQTGNQWQMKT-SEGRHPVSSQYRMHSYYGPPSYLG 299

  Fly   253 -------LFNLTASLSPART---GPPSSPESDLDVDSAPDEATPENLS--LKKEDSQSPPNTPAE 305
                   .|....|.|.|:.   .||||.:|.|...|:....:.|:..  |:.|.:.|.|::.|.
  Rat   300 QSMSQIFTFEEGPSYSEAKASVFSPPSSQDSGLVSLSSSSPMSNESTKGVLECESASSEPSSYAV 364

  Fly   306 N 306
            |
  Rat   365 N 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt99BNP_524549.1 DM 37..83 CDD:279137 36/45 (80%)
CUE_DMA_DMRTA1 378..415 CDD:270600
Dmrt1NP_446158.1 DM 70..116 CDD:279137 36/45 (80%)
Dmrt1 128..200 CDD:289167 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.