DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp99b

DIOPT Version :9

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:141 Identity:33/141 - (23%)
Similarity:63/141 - (44%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYLIVALALCAVAHAD------DWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPDV 60
            :|.|||.|...|...||      |:..||.|::...|..|:::...|.:.:.:.|...:|::...
  Fly     1 MKVLIVLLLGLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPDDAVT 65

  Fly    61 RQYLTCSAIKLGIFCDQQGYHADRLAKQF-----KMDLSEEEALQIAQSCVDDNAQKNPTDVWAF 120
            ..||.|...|.|.:..:.|:...::..|.     ::..|:|...:||. |.:.::::..:...|:
  Fly    66 HCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAH-CAETHSKEGDSCSKAY 129

  Fly   121 RGHQCMMASKI 131
            ....|.|.|.:
  Fly   130 HAGMCFMNSNL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 25/121 (21%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D93539at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.