DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp83ef

DIOPT Version :9

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:133 Identity:23/133 - (17%)
Similarity:55/133 - (41%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIVALALCAVAHADDWTPKTGEEIRKIRVDCLKENPLSNDQ-----ISQLKNLIFPNEPDVRQYL 64
            |:....:|:.|.||  .....:.:.|    ||::  ||:.:     :.:|:........:|...:
  Fly     8 LVSLFLICSQALAD--LSGDAQTLEK----CLRQ--LSSPESIAGDLRKLERYSSWTREEVPCLM 64

  Fly    65 TCSAIKLGIF-CDQQGYHADRLAKQFKMDLSEEEALQIAQSCVDDNAQKNPTDVWAFRGHQCMMA 128
            .|.|.:.|.| .::..:...:|.:....|:......::.:...|..:       :|:||.:|:..
  Fly    65 RCLAREKGWFDVEENKWRLKQLTEDLGADVYNYCRFELRRMGSDGCS-------FAYRGLRCLKQ 122

  Fly   129 SKI 131
            :::
  Fly   123 AEM 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 20/116 (17%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 18/108 (17%)
PhBP 133..234 CDD:214783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.