DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp83a

DIOPT Version :10

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:131 Identity:23/131 - (17%)
Similarity:54/131 - (41%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIVALALC--------AVAHADDWTPKTG--EEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPD 59
            |::||:|.        |.|..|:..|..|  :..:.....|:::..::...|.:..:.....:..
  Fly    35 LLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDGEIHEDEK 99

  Fly    60 VRQYLTCSAIKLGIFCDQQGYHADRLAKQFKMDLSEEEALQIAQSCVDDNAQKNPTDVWAFRGHQ 124
            ::.|:.|...::.:..|....|.::|.....:.: .::.:::::.||...........|.|  ||
  Fly   100 LKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSM-RDKLMEMSKGCVHPEGDTLCHKAWWF--HQ 161

  Fly   125 C 125
            |
  Fly   162 C 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 19..128 CDD:460193 16/109 (15%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 14/95 (15%)

Return to query results.
Submit another query.