DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp69a

DIOPT Version :9

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:112 Identity:29/112 - (25%)
Similarity:53/112 - (47%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PKTGEEIRKIRVDCLKENPLSNDQISQ-LKNLIFPNEPDVRQYLTCSAIKLGIFCDQQGYHADRL 85
            |...:::||:|:.||.:...|.|.|.: :||.|.|.:|:::.:|.|.....|:...|...|.:.|
  Fly    29 PTIIKQVRKLRMRCLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEAL 93

  Fly    86 AKQFKMDLSEEEALQ----IAQSCVDDNAQKNPTDVWAFRGHQCMMA 128
                 :::..||..:    :..||..... |:..|. |:...:|.:|
  Fly    94 -----LEVLPEEIHKTINGLVSSCGTQKG-KDGCDT-AYETVKCYIA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 28/110 (25%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.