DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp47a

DIOPT Version :10

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:130 Identity:30/130 - (23%)
Similarity:48/130 - (36%) Gaps:42/130 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIF--PNEPDVRQYLTCSAIKLGIFCDQQGYH 81
            |.:|||..| ..||: |..:..:|..::::|:...|  |:| .|:.:..|...::|:..|  |..
  Fly    34 DESPKTITE-EMIRL-CGDQTDISLRELNKLQREDFSDPSE-SVQCFTHCLYEQMGLMHD--GVF 93

  Fly    82 ADRLAKQFKMDLSEEEALQIAQSCVDDNAQKNPTDVW----------------AFRGHQCMMASK 130
            .:|.......|:|.                   ||.|                |:|.|||....|
  Fly    94 VERDLFGLLSDVSN-------------------TDYWPERQCHAIRGNNKCETAYRIHQCQQQLK 139

  Fly   131  130
              Fly   140  139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 19..128 CDD:460193 29/126 (23%)
Obp47aNP_610632.1 PhBP 44..132 CDD:214783 21/110 (19%)

Return to query results.
Submit another query.