DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp57e

DIOPT Version :9

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster


Alignment Length:101 Identity:27/101 - (26%)
Similarity:43/101 - (42%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKYLIVALA---LCA--VAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQ-LKNLIFPNEPD 59
            ||..|.:.|.   |||  :|:...:.|            |:.:|.||..:..| ::|  :|..|.
  Fly     1 MLDQLTLCLLLNFLCANVLANTSVFNP------------CVSQNELSEYEAHQVMEN--WPVPPI 51

  Fly    60 VRQY---LTCSAIKLGIFCDQQGYHADRLAKQFKMD 92
            .|.|   |||..:.||:..::.....|:..|...:|
  Fly    52 DRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 19/80 (24%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.