DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp83g

DIOPT Version :9

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:55/140 - (39%) Gaps:25/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYLIVALALCAVA----------HADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIFPN 56
            |..::.|:|...||          |||  ..|..||       |.::..:.:|...:..|..||.
  Fly     6 LLLIVAAVATFLVAQTTAKFLLKDHAD--AEKAFEE-------CREDYYVPDDIYEKYLNYEFPA 61

  Fly    57 EPDVRQYLTCSAIKLGIFCDQQGYHADRLAKQFKMDLSEEEALQIAQ----SCVDDNAQKNPTDV 117
            ......::.|...||.:|.:::|:....:..||....|::  |...|    .|:|.|..::....
  Fly    62 HRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKD--LSTVQHGLEKCIDHNEAESDVCT 124

  Fly   118 WAFRGHQCMM 127
            ||.|...|.:
  Fly   125 WANRVFSCWL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 27/115 (23%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.