DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy5

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_072122.2 Gene:Adcy5 / 64532 RGDID:71014 Length:1262 Species:Rattus norvegicus


Alignment Length:304 Identity:76/304 - (25%)
Similarity:140/304 - (46%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 LDGLTCNGLFISDIPLHDATREVILVGEQAR------------------AQDGLRRRMDKIKNSI 421
            |.|:..:.|.:: |.||...::..|:.:...                  |:...|:...:.:..|
  Rat   353 LSGVLLSALHLA-ISLHTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECI 416

  Fly   422 EEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAK------------TYPDVTILFSDIVG 474
             :|.....:|.::...||..:.|..:|  :.:.:.|:||            .:.:|:|||:||.|
  Rat   417 -QARLHSQRENQQQERLLLSVLPRHVA--MEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEG 478

  Fly   475 FTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMAL 539
            |||:.|:.|...::..|..|:..||:........:::.:||.|...|||..|....||....|.:
  Rat   479 FTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGM 543

  Fly   540 KMIDACS--KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKIN 602
            .||:|.|  :.:|  |..:.||:|:|:|.|..||:|.:..::.::.:.||:||..|:|.:|.:|:
  Rat   544 DMIEAISLVREVT--GVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIH 606

  Fly   603 VSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLE 646
            ::..|.::|..    ::|::           |..||....|..|
  Rat   607 ITKATLNYLNG----DYEVE-----------PGCGGERNAYLKE 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 16/93 (17%)
CYCc 430..619 CDD:214485 59/202 (29%)
Guanylate_cyc 457..647 CDD:278633 60/204 (29%)
Adcy5NP_072122.2 AC_N 1..459 CDD:318454 19/109 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..196
Guanylate_cyc 461..634 CDD:306677 56/189 (30%)
DUF1053 669..761 CDD:399378
Guanylate_cyc 1063..1257 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.