DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_570135.2 Gene:Adcy3 / 64508 RGDID:71009 Length:1144 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:130/252 - (51%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 RRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAK-------------TYP 463
            |:..::|.::||.:     ::::|:.|  .|.|..:|:::......|..             .:.
  Rat   259 RQSLEVKMNLEEQS-----QQQENLML--SILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHE 316

  Fly   464 DVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASI 528
            :|:|||:||||||.:.|..:...::.:|..|:..||:....:...:::.:||.|....||  ...
  Rat   317 NVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGL--PDY 379

  Fly   529 YDAHKVA--WMALKMIDACS--KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIA 589
            .:.|.|.  .|.|.|::|.|  :..|..|  :.||:|:||||||.||:|:|..:|.::...||:|
  Rat   380 REDHAVCSILMGLAMVEAISYVREKTKTG--VDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVA 442

  Fly   590 NKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLE 646
            ||.|:|....::::|.:|.|.|   :| ||:::|.|           ||:. |.:|:
  Rat   443 NKMEAGGIPGRVHISQSTMDCL---KG-EFDVEPGD-----------GGSR-CDYLD 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 9/38 (24%)
CYCc 430..619 CDD:214485 61/205 (30%)
Guanylate_cyc 457..647 CDD:278633 64/207 (31%)
Adcy3NP_570135.2 AC_N <44..303 CDD:318454 10/50 (20%)
Guanylate_cyc 310..494 CDD:306677 63/194 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..563
Guanylate_cyc 914..1121 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.