DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and adcy1b

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:274 Identity:77/274 - (28%)
Similarity:133/274 - (48%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEAN 425
            :|:|||         .|:..:|||:.            ::.|:|:     |:...:.:|.||| .
Zfish   194 ANTLLF---------TGVNVSGLFVR------------ILTERAQ-----RKAFLQARNCIEE-R 231

  Fly   426 SAVTKERKKNVSLLHLIFPAEIA-----------EKLWLGSSIDAKTYPDVTILFSDIVGFTSIC 479
            ..:..|.:|...||..:.|..:|           |:::  ..|..:.:.:|:|||:||||.||:.
Zfish   232 LRMEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIF--HKIYIQRHDNVSILFADIVGSTSLA 294

  Fly   480 SRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDA 544
            |:.|...::.:|..|:..|||........:::.:||.|...|||.:.....||....|.|.|||.
Zfish   295 SQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDT 359

  Fly   545 CSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKD 609
            .:.........:.||:|||||.||.||:|.:..:|.::.:.||:||..|:|....|::::.:|.:
Zfish   360 ITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLPGKVHITRSTLE 424

  Fly   610 WLTKHEGFEFELQP 623
            .|..    ::|::|
Zfish   425 CLNG----DYEVEP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 22/100 (22%)
CYCc 430..619 CDD:214485 60/199 (30%)
Guanylate_cyc 457..647 CDD:278633 55/167 (33%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831 22/104 (21%)
CYCc 236..431 CDD:214485 60/200 (30%)
Guanylate_cyc 272..454 CDD:278633 55/167 (33%)
DUF1053 498..585 CDD:283888
CYCc 806..1012 CDD:214485
Guanylate_cyc 839..1035 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.