DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and npr3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:232 Identity:49/232 - (21%)
Similarity:89/232 - (38%) Gaps:42/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLTAPSNEDLNTAVTSLVAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASAS-- 111
            |:..|..|...::||.:.:.:  |.|.|....|..........|.:|..|....|||.|...:  
Zfish    97 LVLGPVCEYAASSVTRVASHW--NIPVISAGALATGFNSKTPEYSHLTRIAPTYLKMAETFQAIF 159

  Fly   112 ------EILVLLGEELITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCA 170
                  ...::..::.....|...:|..|    |.|.|:..|.|  :.||...||.|...|.:.:
Zfish   160 GHFGWRTAYLIYDDDKDERNCYFTMEGVF----TVLSEYHISTD--FAVLNSNEERVDPDGIITS 218

  Fly   171 --GEGELIFTSERPVIAWLLLGS----LKALTRMLYKVDVNIKIEPVEGDARR-----------Y 218
              |...:|..|:..::..|:|.:    |.:.:.:.:.:::.......:|..||           |
Zfish   219 VYGSEVVIMCSKADIVRDLMLAAHRRKLTSDSHIFFNIELFNSSSYGDGSWRRRDKYDDEARAAY 283

  Fly   219 RYLFSLVKDNSQTMLMG-RP--TSVSKTIPETVQRSN 252
            .:|      |:.|:|.. :|  ...|..:.:::|:||
Zfish   284 SFL------NTVTLLRSTKPEFEDFSIEMKKSLQQSN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 29/145 (20%)
HNOBA 259..451 CDD:285003
CYCc 430..619 CDD:214485
Guanylate_cyc 457..647 CDD:278633
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 49/232 (21%)
ANF_receptor 46..389 CDD:279440 49/232 (21%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.