DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and adcy6b

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_002666536.2 Gene:adcy6b / 560807 ZFINID:ZDB-GENE-090127-2 Length:1174 Species:Danio rerio


Alignment Length:476 Identity:107/476 - (22%)
Similarity:197/476 - (41%) Gaps:106/476 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 RRYRYLFSLVKDNSQTMLMGRPTSVSKTI---------PETVQRSNSSNASDLQM------NSSS 265
            |.|:..|..:..:|.|||||....|...:         |:....|..|.|..|.:      |.:.
Zfish   146 RLYQRYFFRLNQSSLTMLMGVLVVVCGVMLAFHCVQGPPDVAYASVLSVAMGLFLTLMVVCNRNG 210

  Fly   266 FCKMFPW--HFIMNEQLELVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTY 328
            |.:.:.|  .:::...|.:||: .|...:..|.|.: |...|.:|.:             :..|.
Zfish   211 FHQDYMWIVSYLVMGVLVVVQV-FGLLMVDPPSMPE-GIWWTVFFIY-------------IIYTL 260

  Fly   329 TPFLIGLNNPPGAV-----DFPAIGLEIKGQMVH---CPESNSLLFIGSPFLDGLDGLTCNGLFI 385
            .|..:......|||     ...|....::...::   |  :|:::|:            |.    
Zfish   261 LPVRMRAAVITGAVLSTIHIVMAWRFNLEDSFLYKQLC--ANAMIFL------------CT---- 307

  Fly   386 SDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEK 450
                      .:|.:.....|:...|:...:.:..| :|...:.:|.::...||..:.|..:|  
Zfish   308 ----------NIIGICTHYPAEVSQRQAFKETRGYI-QARIHLQRENQQQERLLLSVLPRHVA-- 359

  Fly   451 LWLGSSIDAK------------TYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCD 503
            :.:.:.|:||            .:.:|:|||:||.||||:.|:.|...::..|..|:..||:...
Zfish   360 MEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAW 424

  Fly   504 FFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACS--KHITHDGEQIKMRIGLHTGT 566
            .....:::.:||.|...|||.......||....|.:.||:|.|  :.:|  |..:.||:|:|:|.
Zfish   425 ENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVT--GVNVNMRVGIHSGR 487

  Fly   567 VLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPK 631
            |..||:|.:..::.::.:.||:||:.|:|.:|.:|:::..|..:|..    ::|:   :..|   
Zfish   488 VHCGVLGLRKWQFDVWSNDVTLANQMEAGGKAGRIHITKATLQYLNG----DYEV---EAGF--- 542

  Fly   632 EFPNPGGTETCYF----LESF 648
                 ||....|.    :|:|
Zfish   543 -----GGDRNAYLNNNNIETF 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 33/207 (16%)
CYCc 430..619 CDD:214485 58/202 (29%)
Guanylate_cyc 457..647 CDD:278633 58/207 (28%)
adcy6bXP_002666536.2 AC_N 15..376 CDD:318454 50/275 (18%)
Guanylate_cyc 378..562 CDD:306677 57/198 (29%)
DUF1053 590..677 CDD:310728
Guanylate_cyc 975..1169 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.