DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and npr1a

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:380 Identity:129/380 - (33%)
Similarity:193/380 - (50%) Gaps:73/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 MADFGCQATTYFDFKRPKGLTMKFRDIVRRTYT-PFLIGLNNPPGA----VDFPAIGL------- 349
            :.|:|.::     |.:...|........|:.:| |.|:..:|||..    .|..:.|:       
Zfish   682 ITDYGLES-----FHKDSNLDDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELAL 741

  Fly   350 ---------------EIKGQMVH----------CPESNS-----LLFIGSPFLDGLDGLTCNGLF 384
                           ||..::|.          ||:|:|     |:            |.|....
Zfish   742 LKGVFYLEGPCLSPKEIIERVVEGRWPYLRPLLCPQSHSEEMGQLM------------LRCWSED 794

  Fly   385 ISDIPLHDATREVILV-----GEQARAQDGLRRRMDKIKNS----IEEANSAVTKERKKNVSLLH 440
            :::.|  |.::..:|:     |..:...|.|..||::..|:    :||...|..:|::|..:||:
Zfish   795 VNERP--DFSQIKVLLRKNNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLY 857

  Fly   441 LIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFF 505
            .|.|..:||:|..|..:.|:.:..|||.||||||||::.:.:||..|:::|..||..||...|.|
Zfish   858 QILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNF 922

  Fly   506 DVYKVETIGDAYCVASGLH-RASIYDAHKVAWMALKMIDAC-SKHITH-DGEQIKMRIGLHTGTV 567
            ||||||||||||.|.|||. |.....|.::|.|:|.:::|. |..|.| ...|:::|||:|:|.|
Zfish   923 DVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPV 987

  Fly   568 LAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQ 622
            .|||||.|||||||||.:|..|::.||..|||||:||..|:..|.:...|:.||:
Zfish   988 CAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELR 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 43/204 (21%)
CYCc 430..619 CDD:214485 92/191 (48%)
Guanylate_cyc 457..647 CDD:278633 84/169 (50%)
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944 26/150 (17%)
TyrKc 554..808 CDD:197581 25/144 (17%)
HNOBA <823..868 CDD:285003 15/44 (34%)
CYCc 847..1032 CDD:214485 90/184 (49%)
Guanylate_cyc 874..1060 CDD:278633 84/169 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.