DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and adcy2b

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b / 557902 ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio


Alignment Length:244 Identity:73/244 - (29%)
Similarity:120/244 - (49%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 VSLL--HL--IFPAEIAEKLWLGSSID------------AKTYPDVTILFSDIVGFTSICSRATP 484
            :|||  |:  :..|||.::| .|.:..            .:.:.:|:||::||||||.:.|..:|
Zfish   292 LSLLPAHIARVMKAEIIQRL-KGPNFSQAENTNNFHNLYVQRHTNVSILYADIVGFTRLASDCSP 355

  Fly   485 FMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACSKHI 549
            ..::.||..|:..||:.....|..:::.:||.|...|||....:..|.....|.|.|.:|..|..
Zfish   356 GELVYMLNELFGKFDQIAKDNDCMRIKILGDCYYCVSGLPDPLLDHAKNCVKMGLDMCEAIEKVR 420

  Fly   550 THDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKH 614
            ...|..|.||:|:|:|.||.||:|.:..:|.::.|.||:||..|:|....::::|..|.:.|  :
Zfish   421 EATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHL--N 483

  Fly   615 EGFEFEL---QPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSELPLV 660
            ..::.|.   |.|| |:|.:.     |..|...:    ||..:...||:
Zfish   484 GAYKVEQGNGQSRD-SYLKEH-----GIVTYLVI----NPKAEKRSPLL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 7/18 (39%)
CYCc 430..619 CDD:214485 61/198 (31%)
Guanylate_cyc 457..647 CDD:278633 60/204 (29%)
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831 5/14 (36%)
CYCc 283..486 CDD:214485 61/196 (31%)
Guanylate_cyc 328..512 CDD:278633 60/195 (31%)
DUF1053 542..646 CDD:283888
CYCc 899..1106 CDD:214485
Guanylate_cyc 929..1128 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.